PFDN6 anticorps (N-Term)

N° du produit ABIN631922

Détail du produit anti-PFDN6 anticorps

Antigène: PFDN6 (Prefoldin Subunit 6 (PFDN6))

Épitope: N-Term

Reactivité: Humain, Souris, Rat, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PFDN6 est non-conjugé

Application: Western Blotting (WB)

Specificité: PFDN6 antibody was raised against the N terminal of PFDN6

Purification: Affinity purified

Immunogène: PFDN6 antibody was raised using the N terminal of PFDN6 corresponding to a region with amino acids MAELIQKKLQGEVEKYQQLQKDLSKSMSGRQKLEAQLTENNIVKEELALL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PFDN6 Blocking Peptide, catalog no. 33R-5640, is also available for use as a blocking control in assays to test for specificity of this PFDN6 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PFDN6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PFDN6

Antigène: PFDN6 (Prefoldin Subunit 6 (PFDN6))

Autre désignation: PFDN6 (PFDN6 Produits)

Synonymes: anticorps hke2, anticorps ke-2, anticorps pfd6, anticorps h2-ke2, anticorps pfdn6a, anticorps 23.m05913, anticorps H-2Ke2, anticorps Ke-2, anticorps Pfdn6, anticorps H2-KE2, anticorps HKE2, anticorps KE-2, anticorps PFD6, anticorps zgc:66282, anticorps pfdn6, anticorps pfdn6b, anticorps Ke2, anticorps prefoldin subunit 6 S homeolog, anticorps prefoldin subunit 6 (predicted), anticorps prefoldin subunit 6, anticorps prefoldin subunit 6 L homeolog, anticorps pfdn6.S, anticorps SPAC3A11.13, anticorps BBOV_IV004800, anticorps AOR_1_2254174, anticorps CMU_042830, anticorps pfdn6, anticorps Pfdn6, anticorps PFDN6, anticorps pfdn6.L

Sujet: PFDN6 binds specifically to cytosolic chaperonin (c-CPN) and transfers target proteins to it. PFDN6 binds to nascent polypeptide chain and promotes folding in an environment in which there are many competing pathways for nonnative proteins.

Poids moléculaire: 14 kDa (MW of target protein)

Pathways: Unfolded Protein Response