NRARP anticorps (Middle Region)

N° du produit ABIN631926

Cet anticorps anti-NRARP Polyclonal Lapin (ABIN631926) détecte spécifiquement NRARP dans WB. L’anticorps est réactif avec des échantillons de Humain, Souris et Rat.

Aperçu rapide pour NRARP anticorps (Middle Region) (ABIN631926)

Antigène: NRARP (NOTCH-Regulated Ankyrin Repeat Protein (NRARP))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp NRARP est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-NRARP anticorps

Épitope: Middle Region

Specificité: NRARP antibody was raised against the middle region of NRARP

Purification: Affinity purified

Immunogène: NRARP antibody was raised using the middle region of NRARP corresponding to a region with amino acids QNMTNCEFNVNSFGPEGQTALHQSVIDGNLELVKLLVKFGADIRLANRDG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

NRARP Blocking Peptide, (ABIN5615058), is also available for use as a blocking control in assays to test for specificity of this NRARP antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NRARP antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur NRARP

Antigène: NRARP (NOTCH-Regulated Ankyrin Repeat Protein (NRARP))

Autre désignation: NRARP

Sujet: NRARP may play a role in the formation of somites.

Poids moléculaire: 12 kDa (MW of target protein)