PARP12 anticorps

N° du produit ABIN631944

Détail du produit anti-PARP12 anticorps

Antigène: PARP12 (Poly (ADP-Ribose) Polymerase Family, Member 12 (PARP12))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PARP12 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: PARP12 antibody was raised using a synthetic peptide corresponding to a region with amino acids FYDSCVNSVSDPSIFVIFEKHQVYPEYVIQYTTSSKPSVTPSILLALGSL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PARP12 Blocking Peptide, catalog no. 33R-3134, is also available for use as a blocking control in assays to test for specificity of this PARP12 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PARP12 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PARP12

Antigène: PARP12 (Poly (ADP-Ribose) Polymerase Family, Member 12 (PARP12))

Autre désignation: PARP12 (PARP12 Produits)

Synonymes: anticorps ARTD12, anticorps MST109, anticorps MSTP109, anticorps ZC3H1, anticorps ZC3HDC1, anticorps 9930021O16, anticorps AA409132, anticorps AA536654, anticorps PARP-12, anticorps Zc3hdc1, anticorps PARP12, anticorps zc3h1, anticorps mst109, anticorps mstp109, anticorps zc3hdc1, anticorps si:ch211-227d19.2, anticorps poly(ADP-ribose) polymerase family member 12, anticorps poly (ADP-ribose) polymerase family, member 12, anticorps poly(ADP-ribose) polymerase family member 12 L homeolog, anticorps poly (ADP-ribose) polymerase family, member 12a, anticorps poly [ADP-ribose] polymerase 12, anticorps PARP12, anticorps Parp12, anticorps parp12.L, anticorps parp12a, anticorps parp12, anticorps LOC100561568

Sujet: The function of PARP12 protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 79 kDa (MW of target protein)