PARP12 anticorps
-
- Antigène Tous les produits PARP12
- PARP12 (Poly (ADP-Ribose) Polymerase Family, Member 12 (PARP12))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp PARP12 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- PARP12 antibody was raised using a synthetic peptide corresponding to a region with amino acids FYDSCVNSVSDPSIFVIFEKHQVYPEYVIQYTTSSKPSVTPSILLALGSL
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
PARP12 Blocking Peptide, catalog no. 33R-3134, is also available for use as a blocking control in assays to test for specificity of this PARP12 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PARP12 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- PARP12 (Poly (ADP-Ribose) Polymerase Family, Member 12 (PARP12))
- Autre désignation
- PARP12 (PARP12 Produits)
- Synonymes
- anticorps ARTD12, anticorps MST109, anticorps MSTP109, anticorps ZC3H1, anticorps ZC3HDC1, anticorps 9930021O16, anticorps AA409132, anticorps AA536654, anticorps PARP-12, anticorps Zc3hdc1, anticorps PARP12, anticorps zc3h1, anticorps mst109, anticorps mstp109, anticorps zc3hdc1, anticorps si:ch211-227d19.2, anticorps poly(ADP-ribose) polymerase family member 12, anticorps poly (ADP-ribose) polymerase family, member 12, anticorps poly(ADP-ribose) polymerase family member 12 L homeolog, anticorps poly (ADP-ribose) polymerase family, member 12a, anticorps poly [ADP-ribose] polymerase 12, anticorps PARP12, anticorps Parp12, anticorps parp12.L, anticorps parp12a, anticorps parp12, anticorps LOC100561568
- Sujet
- The function of PARP12 protein is not widely studied, and is yet to be elucidated fully.
- Poids moléculaire
- 79 kDa (MW of target protein)
-