ASCC2 anticorps (Middle Region)
-
- Antigène Voir toutes ASCC2 Anticorps
- ASCC2 (Activating Signal Cointegrator 1 Complex Subunit 2 (ASCC2))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp ASCC2 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- ASCC2 antibody was raised against the middle region of ASCC2
- Purification
- Affinity purified
- Immunogène
- ASCC2 antibody was raised using the middle region of ASCC2 corresponding to a region with amino acids YEDEYDDTYDGNQVGANDADSDDELISRRPFTIPQVLRTKVPREGQEEDD
- Top Product
- Discover our top product ASCC2 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
ASCC2 Blocking Peptide, catalog no. 33R-10082, is also available for use as a blocking control in assays to test for specificity of this ASCC2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ASCC2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- ASCC2 (Activating Signal Cointegrator 1 Complex Subunit 2 (ASCC2))
- Autre désignation
- ASCC2 (ASCC2 Produits)
- Synonymes
- anticorps MGC63666, anticorps zgc:63666, anticorps ASCC2, anticorps ascc2, anticorps asc1p100, anticorps ASC1p100, anticorps p100, anticorps 1700011I11Rik, anticorps 2610034L15Rik, anticorps AI482016, anticorps AW046480, anticorps RGD1561422, anticorps activating signal cointegrator 1 complex subunit 2, anticorps activating signal cointegrator 1 complex subunit 2 S homeolog, anticorps ascc2, anticorps ASCC2, anticorps MCYG_08331, anticorps ascc2.S, anticorps Ascc2
- Sujet
- ASCC2 belongs to the ASCC2 family. It contains 1 CUE domain. ASCC2 enhances NF-kappa-B, SRF and AP1 transactivation.
- Poids moléculaire
- 86 kDa (MW of target protein)
-