ASCC2 anticorps (Middle Region)

N° du produit ABIN631946

Détail du produit anti-ASCC2 anticorps

Antigène: ASCC2 (Activating Signal Cointegrator 1 Complex Subunit 2 (ASCC2))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ASCC2 est non-conjugé

Application: Western Blotting (WB)

Specificité: ASCC2 antibody was raised against the middle region of ASCC2

Purification: Affinity purified

Immunogène: ASCC2 antibody was raised using the middle region of ASCC2 corresponding to a region with amino acids YEDEYDDTYDGNQVGANDADSDDELISRRPFTIPQVLRTKVPREGQEEDD

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ASCC2 Blocking Peptide, catalog no. 33R-10082, is also available for use as a blocking control in assays to test for specificity of this ASCC2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ASCC2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ASCC2

Antigène: ASCC2 (Activating Signal Cointegrator 1 Complex Subunit 2 (ASCC2))

Autre désignation: ASCC2 (ASCC2 Produits)

Synonymes: anticorps MGC63666, anticorps zgc:63666, anticorps ASCC2, anticorps ascc2, anticorps asc1p100, anticorps ASC1p100, anticorps p100, anticorps 1700011I11Rik, anticorps 2610034L15Rik, anticorps AI482016, anticorps AW046480, anticorps RGD1561422, anticorps activating signal cointegrator 1 complex subunit 2, anticorps activating signal cointegrator 1 complex subunit 2 S homeolog, anticorps ascc2, anticorps ASCC2, anticorps MCYG_08331, anticorps ascc2.S, anticorps Ascc2

Sujet: ASCC2 belongs to the ASCC2 family. It contains 1 CUE domain. ASCC2 enhances NF-kappa-B, SRF and AP1 transactivation.

Poids moléculaire: 86 kDa (MW of target protein)