MGMT anticorps (Middle Region)

N° du produit ABIN631949

L’anticorps anti-MGMT Polyclonal Lapin est utilisé pour la détection de MGMT dans des échantillons de Humain. Il a été validé pour WB.

Aperçu rapide pour MGMT anticorps (Middle Region) (ABIN631949)

Antigène: MGMT (O6-Methylguanine-DNA-Methyltransferase (MGMT))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MGMT est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-MGMT anticorps

Épitope: Middle Region

Specificité: MGMT antibody was raised against the middle region of MGMT

Purification: Affinity purified

Immunogène: MGMT antibody was raised using the middle region of MGMT corresponding to a region with amino acids ISYQQLAALAGNPKAARAVGGAMRGNPVPILIPCHRVVCSSGAVGNYSGG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

MGMT Blocking Peptide, (ABIN939556), is also available for use as a blocking control in assays to test for specificity of this MGMT antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MGMT antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur MGMT

Antigène: MGMT (O6-Methylguanine-DNA-Methyltransferase (MGMT))

Autre désignation: MGMT

Sujet: MGMT is involved in the cellular defense against the biological effects of O6-methylguanine (O6-MeG) in DNA.MGMT repairs alkylated guanine in DNA by stoichiometrically transferring the alkyl group at the O-6 position to a cysteine residue in the enzyme. This is a suicide reaction: the enzyme is irreversibly inactivated.

Poids moléculaire: 22 kDa (MW of target protein)

Pathways: Réparation de l'ADN, Positive Regulation of Response to DNA Damage Stimulus