Caldesmon anticorps (C-Term)

N° du produit ABIN631993

Cet anticorps Lapin Polyclonal détecte spécifiquement Caldesmon dans WB. Il présente une réactivité envers Humain.

Aperçu rapide pour Caldesmon anticorps (C-Term) (ABIN631993)

Antigène: Caldesmon (CALD1) (Caldesmon 1 (CALD1))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Caldesmon est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-Caldesmon anticorps

Épitope: C-Term

Specificité: Caldesmon 1 antibody was raised against the C terminal of CALD1

Purification: Affinity purified

Immunogène: Caldesmon 1 antibody was raised using the C terminal of CALD1 corresponding to a region with amino acids VLEEEEQRRKQEEADRKLREEEEKRRLKEEIERRRAEAAEKRQKMPEDGL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Caldesmon 1 Blocking Peptide, (ABIN5612578), is also available for use as a blocking control in assays to test for specificity of this Caldesmon 1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CALD1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Caldesmon

Antigène: Caldesmon (CALD1) (Caldesmon 1 (CALD1))

Autre désignation: Caldesmon 1

Sujet: CALD1 is a calmodulin- and actin-binding protein that plays an essential role in the regulation of smooth muscle and nonmuscle contraction. The conserved domain of this protein possesses the binding activities to Ca(2+)-calmodulin, actin, tropomyosin, myosin, and phospholipids.

Poids moléculaire: 93 kDa (MW of target protein)

Pathways: Myometrial Relaxation and Contraction