Carabin anticorps (N-Term)

N° du produit ABIN632014

Cet anticorps Lapin Polyclonal détecte spécifiquement Carabin dans WB. Il présente une réactivité avec des échantillons de Humain.

Aperçu rapide pour Carabin anticorps (N-Term) (ABIN632014)

Antigène: Carabin (TBC1D10C) (TBC1 Domain Family, Member 10C (TBC1D10C))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Carabin est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-Carabin anticorps

Épitope: N-Term

Specificité: TBC1 D11 antibody was raised against the N terminal of TBC1 11

Purification: Affinity purified

Immunogène: TBC1 D11 antibody was raised using the N terminal of TBC1 11 corresponding to a region with amino acids MAQALGEDLVQPPELQDDSSSLGSDSELSGPGPYRQADRYGFIGGSSAEP

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TBC1D10C Blocking Peptide, (ABIN5616512), is also available for use as a blocking control in assays to test for specificity of this TBC1D10C antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TBC0 10 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Carabin

Antigène: Carabin (TBC1D10C) (TBC1 Domain Family, Member 10C (TBC1D10C))

Autre désignation: TBC1D10C

Sujet: TBC1D10C inhibits the Ras signaling pathway through its intrinsic Ras GTPase-activating protein (GAP) activity. TBC1D10C acts as a negative feedback inhibitor of the calcineurin signaling pathway that also mediates crosstalk between calcineurin and Ras.

Poids moléculaire: 50 kDa (MW of target protein)