Carabin anticorps (N-Term)

N° du produit ABIN632014

Détail du produit anti-Carabin anticorps

Antigène: Carabin (TBC1D10C) (TBC1 Domain Family, Member 10C (TBC1D10C))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Carabin est non-conjugé

Application: Western Blotting (WB)

Specificité: TBC1 D11 antibody was raised against the N terminal of TBC1 11

Purification: Affinity purified

Immunogène: TBC1 D11 antibody was raised using the N terminal of TBC1 11 corresponding to a region with amino acids MAQALGEDLVQPPELQDDSSSLGSDSELSGPGPYRQADRYGFIGGSSAEP

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TBC1D10C Blocking Peptide, catalog no. 33R-5723, is also available for use as a blocking control in assays to test for specificity of this TBC1D10C antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TBC0 10 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Carabin

Antigène: Carabin (TBC1D10C) (TBC1 Domain Family, Member 10C (TBC1D10C))

Autre désignation: TBC1D10C (TBC1D10C Produits)

Synonymes: anticorps CARABIN, anticorps EPI64C, anticorps 1810062O14Rik, anticorps AI428527, anticorps RGD1311490, anticorps TBC1 domain family member 10C, anticorps TBC1 domain family, member 10c, anticorps TBC1 domain family, member 10C, anticorps TBC1D10C, anticorps Tbc1d10c

Sujet: TBC1D10C inhibits the Ras signaling pathway through its intrinsic Ras GTPase-activating protein (GAP) activity. TBC1D10C acts as a negative feedback inhibitor of the calcineurin signaling pathway that also mediates crosstalk between calcineurin and Ras.

Poids moléculaire: 50 kDa (MW of target protein)