EN1 anticorps (C-Term)

N° du produit ABIN632046

Cet anticorps anti-EN1 est un anticorps Lapin Polyclonal détectant EN1 dans WB. Adapté pour Humain.

Aperçu rapide pour EN1 anticorps (C-Term) (ABIN632046)

Antigène: EN1 (Engrailed Homeobox 1 (EN1))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp EN1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-EN1 anticorps

Épitope: C-Term

Specificité: EN1 antibody was raised against the C terminal of EN1

Purification: Affinity purified

Immunogène: EN1 antibody was raised using the C terminal of EN1 corresponding to a region with amino acids LMGSANGGPVVKTDSQQPLVWPAWVYCTRYSDRPSSGPRTRKLKKKKNEK

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

EN1 Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this EN1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EN1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur EN1

Antigène: EN1 (Engrailed Homeobox 1 (EN1))

Autre désignation: EN1

Sujet: Homeobox-containing genes are thought to have a role in controlling development. In Drosophila, the 'engrailed' (en) gene plays an important role during development in segmentation, where it is required for the formation of posterior compartments. Different mutations in the mouse homologs, En1 and En2, produced different developmental defects that frequently are lethal. The human engrailed homologs 1 and 2 encode homeodomain-containing proteins and have been implicated in the control of pattern formation during development of the central nervous system.Homeobox-containing genes are thought to have a role in controlling development.

Poids moléculaire: 40 kDa (MW of target protein)

Pathways: Dopaminergic Neurogenesis