RGS22 anticorps (N-Term)

N° du produit ABIN632062

Cet anticorps Lapin Polyclonal détecte spécifiquement RGS22 dans WB. Il présente une réactivité avec des échantillons de Humain.

Aperçu rapide pour RGS22 anticorps (N-Term) (ABIN632062)

Antigène: RGS22 (Regulator of G-Protein Signaling 22 (RGS22))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RGS22 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-RGS22 anticorps

Épitope: N-Term

Specificité: RGS22 antibody was raised against the N terminal of RGS22

Purification: Affinity purified

Immunogène: RGS22 antibody was raised using the N terminal of RGS22 corresponding to a region with amino acids QTVSTFSLPCCVPYNKLKSPAISSVSENFIFDDGVHPRTKKDPSKTNKLI

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RGS22 Blocking Peptide, (ABIN5615847), is also available for use as a blocking control in assays to test for specificity of this RGS22 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RGS22 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RGS22

Antigène: RGS22 (Regulator of G-Protein Signaling 22 (RGS22))

Autre désignation: RGS22

Sujet: RGS22 inhibits signal transduction by increasing the GTPase activity of G protein alpha subunits thereby driving them into their inactive GDP-bound form.

Poids moléculaire: 147 kDa (MW of target protein)

Pathways: Regulation of G-Protein Coupled Receptor Protein Signaling