Casein Kinase 1 gamma 2 anticorps (N-Term)

N° du produit ABIN632066

L’anticorps Lapin Polyclonal anti-Casein Kinase 1 gamma 2 a été validé pour WB. Il convient pour détecter Casein Kinase 1 gamma 2 dans des échantillons de Humain, Souris et Rat.

Aperçu rapide pour Casein Kinase 1 gamma 2 anticorps (N-Term) (ABIN632066)

Antigène: Casein Kinase 1 gamma 2 (CSNK1G2) (Casein Kinase 1, gamma 2 (CSNK1G2))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Casein Kinase 1 gamma 2 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-Casein Kinase 1 gamma 2 anticorps

Épitope: N-Term

Specificité: CK1 gamma 2 antibody was raised against the N terminal of CSNK1 G2

Purification: Affinity purified

Immunogène: CK1 gamma 2 antibody was raised using the N terminal of CSNK1 G2 corresponding to a region with amino acids FDLCDRTFTLKTVLMIAIQLITRMEYVHTKSLIYRDVKPENFLVGRPGTK

Information d'application

Indications d'application: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CK1 gamma 2 Blocking Peptide, (ABIN938253), is also available for use as a blocking control in assays to test for specificity of this CK1 gamma 2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CSNK0 2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Casein Kinase 1 gamma 2

Antigène: Casein Kinase 1 gamma 2 (CSNK1G2) (Casein Kinase 1, gamma 2 (CSNK1G2))

Sujet: CSNK1G2 belongs to the protein kinase superfamily, CK1 Ser/Thr protein kinase family, casein kinase I subfamily. It contains 1 protein kinase domain. Casein kinases are operationally defined by their preferential utilization of acidic proteins such as caseins as substrates. It can phosphorylate a large number of proteins. It participates in Wnt signaling.

Poids moléculaire: 47 kDa (MW of target protein)

Pathways: Signalisation Hedgehog