FABP1 anticorps (N-Term)

N° du produit ABIN632091

Cet anticorps anti-FABP1 Polyclonal Lapin (ABIN632091) détecte spécifiquement FABP1 dans WB. L’anticorps est réactif avec des échantillons de Humain et Souris.

Aperçu rapide pour FABP1 anticorps (N-Term) (ABIN632091)

Antigène: FABP1 (Fatty Acid Binding Protein 1, Liver (FABP1))

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp FABP1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-FABP1 anticorps

Épitope: N-Term

Specificité: FABP1 antibody was raised against the N terminal of FABP1

Purification: Affinity purified

Immunogène: FABP1 antibody was raised using the N terminal of FABP1 corresponding to a region with amino acids MSFSGKYQLQSQENFEAFMKAIGLPEELIQKGKDIKGVSEIVQNGKHFKF

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

FABP1 Blocking Peptide, (ABIN5613445), is also available for use as a blocking control in assays to test for specificity of this FABP1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FABP1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur FABP1

Antigène: FABP1 (Fatty Acid Binding Protein 1, Liver (FABP1))

Autre désignation: FABP1

Sujet: FABP1 encodes the fatty acid binding protein found in liver. Fatty acid binding proteins are a family of small, highly conserved, cytoplasmic proteins that bind long-chain fatty acids and other hydrophobic ligands.

Poids moléculaire: 14 kDa (MW of target protein)

Pathways: Chromatin Binding, Regulation of Lipid Metabolism by PPARalpha