Septin 9 anticorps (Middle Region)

N° du produit ABIN632098

Cet anticorps Lapin Polyclonal détecte spécifiquement Septin 9 dans WB. Il présente une réactivité avec des échantillons de Humain.

Aperçu rapide pour Septin 9 anticorps (Middle Region) (ABIN632098)

Antigène: Septin 9 (SEPT9)

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Septin 9 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-Septin 9 anticorps

Épitope: Middle Region

Specificité: Septin 9 antibody was raised against the middle region of SEPT9

Purification: Affinity purified

Immunogène: Septin 9 antibody was raised using the middle region of SEPT9 corresponding to a region with amino acids VNEKFREMIPFAVVGSDHEYQVNGKRILGRKTKWGTIEVENTTHCEFAYL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Septin 9 Blocking Peptide, (ABIN5616053), is also available for use as a blocking control in assays to test for specificity of this Septin 9 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of 40057 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Septin 9

Antigène: Septin 9 (SEPT9)

Autre désignation: Septin 9

Sujet: This gene is a member of the septin family involved in cytokinesis and cell cycle control. This gene is a candidate for the ovarian tumor suppressor gene. Mutations in this gene cause hereditary neuralgic amyotrophy, also known as neuritis with brachial predilection. A chromosomal translocation involving this gene on chromosome 17 and the MLL gene on chromosome 11 results in acute myelomonocytic leukemia. Multiple alternatively spliced transcript variants encoding different isoforms have been described.

Poids moléculaire: 46 kDa (MW of target protein)