FAM84A anticorps (N-Term)

N° du produit ABIN632110

Cet anticorps Lapin Polyclonal détecte spécifiquement FAM84A dans WB. Il présente une réactivité envers Humain, Rat et Souris.

Aperçu rapide pour FAM84A anticorps (N-Term) (ABIN632110)

Antigène: FAM84A (Family with Sequence Similarity 84, Member A (FAM84A))

Reactivité: Humain, Rat, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp FAM84A est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-FAM84A anticorps

Épitope: N-Term

Specificité: FAM84 A antibody was raised against the N terminal of FAM84

Purification: Affinity purified

Immunogène: FAM84 A antibody was raised using the N terminal of FAM84 corresponding to a region with amino acids GNQLDRITHLNYSELPTGDPSGIEKDELRVGVAYFFSDDEEDLDERGQPD

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

FAM84A Blocking Peptide, (ABIN938841), is also available for use as a blocking control in assays to test for specificity of this FAM84A antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM80 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur FAM84A

Antigène: FAM84A (Family with Sequence Similarity 84, Member A (FAM84A))

Autre désignation: FAM84A

Sujet: FAM84A belongs to the FAM84 family. Up-regulation of FAM84A may play a critical role in progression of colon cancer.

Poids moléculaire: 32 kDa (MW of target protein)