FAM84A anticorps (N-Term)

N° du produit ABIN632110

Détail du produit anti-FAM84A anticorps

Antigène: FAM84A (Family with Sequence Similarity 84, Member A (FAM84A))

Épitope: N-Term

Reactivité: Humain, Rat, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp FAM84A est non-conjugé

Application: Western Blotting (WB)

Specificité: FAM84 A antibody was raised against the N terminal of FAM84

Purification: Affinity purified

Immunogène: FAM84 A antibody was raised using the N terminal of FAM84 corresponding to a region with amino acids GNQLDRITHLNYSELPTGDPSGIEKDELRVGVAYFFSDDEEDLDERGQPD

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

FAM84A Blocking Peptide, catalog no. 33R-3455, is also available for use as a blocking control in assays to test for specificity of this FAM84A antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM80 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur FAM84A

Antigène: FAM84A (Family with Sequence Similarity 84, Member A (FAM84A))

Autre désignation: FAM84A (FAM84A Produits)

Synonymes: anticorps 2310003N02Rik, anticorps 4731402F03Rik, anticorps AW125753, anticorps Nse1, anticorps NSE1, anticorps PP11517, anticorps RGD1305779, anticorps zgc:63724, anticorps family with sequence similarity 84, member A, anticorps family with sequence similarity 84 member A, anticorps Fam84a, anticorps FAM84A, anticorps fam84a

Sujet: FAM84A belongs to the FAM84 family. Up-regulation of FAM84A may play a critical role in progression of colon cancer.

Poids moléculaire: 32 kDa (MW of target protein)