SFRP2 anticorps (Middle Region)

N° du produit ABIN632136

Détail du produit anti-SFRP2 anticorps

Antigène: SFRP2 (Secreted Frizzled-Related Protein 2 (SFRP2))

Épitope: Middle Region

Reactivité: Humain, Souris, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SFRP2 est non-conjugé

Application: Western Blotting (WB)

Specificité: SFRP2 antibody was raised against the middle region of SFRP2

Purification: Affinity purified

Immunogène: SFRP2 antibody was raised using the middle region of SFRP2 corresponding to a region with amino acids DRFPQDNDLCIPLASSDHLLPATEEAPKVCEACKNKNDDDNDIMETLCKN

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SFRP2 Blocking Peptide, catalog no. 33R-2142, is also available for use as a blocking control in assays to test for specificity of this SFRP2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SFRP2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SFRP2

Antigène: SFRP2 (Secreted Frizzled-Related Protein 2 (SFRP2))

Autre désignation: SFRP2 (SFRP2 Produits)

Synonymes: anticorps frp-2, anticorps sarp1, anticorps sdf-5, anticorps sfrp-2, anticorps SFRP2, anticorps sfrp2, anticorps FRP-2, anticorps SARP1, anticorps SDF-5, anticorps AI851596, anticorps Sdf5, anticorps hm:zeh0225, anticorps zeh0225, anticorps zgc:153618, anticorps SFRP-2, anticorps secreted frizzled-related protein 2, anticorps secreted frizzled related protein 2, anticorps secreted frizzled-related protein 2 S homeolog, anticorps secreted frizzled-related protein, anticorps sfrp2, anticorps sfrp2, anticorps SFRP2, anticorps sfrp2.S, anticorps LOAG_01461, anticorps Sfrp2

Sujet: SFRP2 is a member of the SFRP family that contains a cysteine-rich domain homologous to the putative Wnt-binding site of Frizzled proteins. SFRPs act as soluble modulators of Wnt signaling. Methylation of this gene is a potential marker for the presence of colorectal cancer.

Poids moléculaire: 31 kDa (MW of target protein)

Pathways: Signalisation WNT, Tube Formation, Positive Regulation of Endopeptidase Activity, Negative Regulation of intrinsic apoptotic Signaling, Positive Regulation of fat Cell Differentiation