RUVBL2 anticorps

N° du produit ABIN632139

Cet anticorps anti-RUVBL2 est un anticorps Lapin Polyclonal détectant RUVBL2 dans WB et IHC. Adapté pour Humain, Souris, Rat et Chien.

Aperçu rapide pour RUVBL2 anticorps (ABIN632139)

Antigène: RUVBL2 (RuvB-Like 2 (E. Coli) (RUVBL2))

Reactivité: Humain, Souris, Rat, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RUVBL2 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Détail du produit anti-RUVBL2 anticorps

Purification: Affinity purified

Immunogène: RUVBL2 antibody was raised using a synthetic peptide corresponding to a region with amino acids IDRPATGTGSKVGKLTLKTTEMETIYDLGTKMIESLTKDKVQAGDVITID

Information d'application

Indications d'application: WB: 0.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RUVBL2 Blocking Peptide, (ABIN939314), is also available for use as a blocking control in assays to test for specificity of this RUVBL2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RUVBL2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RUVBL2

Antigène: RUVBL2 (RuvB-Like 2 (E. Coli) (RUVBL2))

Autre désignation: RUVBL2

Sujet: RUVBL2 encodes the second human homologue of the bacterial RuvB gene. Bacterial RuvB protein is a DNA helicase essential for homologous recombination and DNA double-strand break repair. Functional analysis showed that this gene product has both ATPase and DNA helicase activities.

Poids moléculaire: 51 kDa (MW of target protein)

Pathways: Telomere Maintenance