RUVBL2 anticorps

N° du produit ABIN632139

Détail du produit anti-RUVBL2 anticorps

Antigène: RUVBL2 (RuvB-Like 2 (E. Coli) (RUVBL2))

Reactivité: Humain, Souris, Rat, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RUVBL2 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Purification: Affinity purified

Immunogène: RUVBL2 antibody was raised using a synthetic peptide corresponding to a region with amino acids IDRPATGTGSKVGKLTLKTTEMETIYDLGTKMIESLTKDKVQAGDVITID

Information d'application

Indications d'application: WB: 0.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RUVBL2 Blocking Peptide, catalog no. 33R-3928, is also available for use as a blocking control in assays to test for specificity of this RUVBL2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RUVBL2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RUVBL2

Antigène: RUVBL2 (RuvB-Like 2 (E. Coli) (RUVBL2))

Autre désignation: RUVBL2 (RUVBL2 Produits)

Synonymes: anticorps ECP51, anticorps INO80J, anticorps REPTIN, anticorps RVB2, anticorps TIH2, anticorps TIP48, anticorps TIP49B, anticorps mp47, anticorps p47, anticorps reptin, anticorps wu:fi25f01, anticorps zreptin, anticorps MGC52995, anticorps tip48, anticorps xReptin, anticorps rvb2, anticorps ecp51, anticorps cgi-46, anticorps tip49b, anticorps MGC69398, anticorps RUVBL2, anticorps AAEL010341, anticorps Reptin, anticorps rept, anticorps RuvB like AAA ATPase 2, anticorps RuvB-like protein 2, anticorps RuvB-like AAA ATPase 2, anticorps RuvB like AAA ATPase 2 L homeolog, anticorps ruvB-like 2, anticorps TATA box-binding protein, anticorps ruvb-like 2, anticorps ruvB-like helicase 2, anticorps RUVBL2, anticorps Ruvbl2, anticorps ruvbl2, anticorps ruvbl2.L, anticorps LOC726816, anticorps HBUT_RS02095, anticorps HAN_2g314, anticorps LOC100282179, anticorps LOC100284260, anticorps LOC5573243

Sujet: RUVBL2 encodes the second human homologue of the bacterial RuvB gene. Bacterial RuvB protein is a DNA helicase essential for homologous recombination and DNA double-strand break repair. Functional analysis showed that this gene product has both ATPase and DNA helicase activities.

Poids moléculaire: 51 kDa (MW of target protein)

Pathways: Telomere Maintenance