TRIB3 anticorps
-
- Antigène Voir toutes TRIB3 Anticorps
- TRIB3 (Tribbles Homolog 3 (Drosophila) (TRIB3))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp TRIB3 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- TRIB3 antibody was raised using a synthetic peptide corresponding to a region with amino acids YVLLEPEEGGRAYQALHCPTGTEYTCKVYPVQEALAVLEPYARLPPHKHV
- Top Product
- Discover our top product TRIB3 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
TRIB3 Blocking Peptide, catalog no. 33R-10278, is also available for use as a blocking control in assays to test for specificity of this TRIB3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TRIB3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- TRIB3 (Tribbles Homolog 3 (Drosophila) (TRIB3))
- Autre désignation
- TRIB3 (TRIB3 Produits)
- Synonymes
- anticorps zgc:76966, anticorps TRIB3, anticorps C20orf97, anticorps NIPK, anticorps SINK, anticorps SKIP3, anticorps TRB3, anticorps Ifld2, anticorps Nipk, anticorps TRB-3, anticorps Trb3, anticorps tribbles pseudokinase 3, anticorps trib3, anticorps TRIB3, anticorps Trib3
- Sujet
- The protein encoded by this gene is a putative protein kinase that is induced by the transcription factor NF-kappaB. The encoded protein is a negative regulator of NF-kappaB and can also sensitize cells to TNF- and TRAIL-induced apoptosis. In addition, this protein can negatively regulate the cell survival serine-threonine kinase AKT1.
- Poids moléculaire
- 39 kDa (MW of target protein)
- Pathways
- Fc-epsilon Receptor Signaling Pathway, EGFR Signaling Pathway, Neurotrophin Signaling Pathway, Regulation of Lipid Metabolism by PPARalpha
-