ERP44 anticorps

N° du produit ABIN632154

Cet anticorps anti-ERP44 est un anticorps Polyclonal produit chez le Lapin, détectant ERP44 dans WB. Convient pour Humain, Souris et Rat.

Aperçu rapide pour ERP44 anticorps (ABIN632154)

Antigène: ERP44 (Endoplasmic Reticulum Protein 44 (ERP44))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ERP44 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-ERP44 anticorps

Purification: Affinity purified

Immunogène: TXNDC4 antibody was raised using a synthetic peptide corresponding to a region with amino acids LHREFHHGPDPTDTAPGEQAQDVASSPPESSFQKLAPSEYRYTLLRDRDE

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TXNDC4 Blocking Peptide, (ABIN940411), is also available for use as a blocking control in assays to test for specificity of this TXNDC4 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TXNDC4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ERP44

Antigène: ERP44 (Endoplasmic Reticulum Protein 44 (ERP44))

Autre désignation: TXNDC4

Sujet: TXNDC4 mediates thiol-dependent retention in the early secretory pathway, forming mixed disulfides with substrate proteins through its conserved CRFS motif. TXNDC4 inhibits the calcium channel activity of ITPR1. TXNDC4 may have a role in the control of oxidative protein folding in the endoplasmic reticulum. TXNDC4 is required to retain ERO1L and ERO1LB in the endoplasmic reticulum.

Poids moléculaire: 45 kDa (MW of target protein)

Pathways: Cell RedoxHomeostasis, SARS-CoV-2 Protein Interactome