C14orf174 anticorps (N-Term)

N° du produit ABIN632166

Cet anticorps anti-C14orf174 est un anticorps Lapin Polyclonal détectant C14orf174 dans WB. Adapté pour Humain.

Aperçu rapide pour C14orf174 anticorps (N-Term) (ABIN632166)

Antigène: C14orf174 (Chromosome 14 Open Reading Frame 174 (C14orf174))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp C14orf174 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-C14orf174 anticorps

Épitope: N-Term

Specificité: C14 ORF174 antibody was raised against the N terminal Of C14 rf174

Purification: Affinity purified

Immunogène: C14 ORF174 antibody was raised using the N terminal Of C14 rf174 corresponding to a region with amino acids FPSEKLGESLEETDLQPPKMTKPETPEETQRESTEKKRTEPPEQARLEFL

Information d'application

Indications d'application: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

C14ORF174 Blocking Peptide, (ABIN938410), is also available for use as a blocking control in assays to test for specificity of this C14ORF174 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF174 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur C14orf174

Antigène: C14orf174 (Chromosome 14 Open Reading Frame 174 (C14orf174))

Autre désignation: C14ORF174

Sujet: C14orf174 contains 1 SAM (sterile alpha motif) domain. The exact functions of C14orf174 remain unknown.

Poids moléculaire: 77 kDa (MW of target protein)