FGFR1OP anticorps (Middle Region)

N° du produit ABIN632197

Cet anticorps Lapin Polyclonal détecte spécifiquement FGFR1OP dans WB. Il présente une réactivité avec des échantillons de Humain.

Aperçu rapide pour FGFR1OP anticorps (Middle Region) (ABIN632197)

Antigène: FGFR1OP (FGFR1 Oncogene Partner (FGFR1OP))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp FGFR1OP est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-FGFR1OP anticorps

Épitope: Middle Region

Specificité: FGFR1 OP antibody was raised against the middle region of FGFR1 P

Purification: Affinity purified

Immunogène: FGFR1 OP antibody was raised using the middle region of FGFR1 P corresponding to a region with amino acids LSDVHSPPKSPEGKTSAQTTPSKIPRYKGQGKKKTSGQKAGDKKANDEAN

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

FGFR1OP Blocking Peptide, (ABIN5613578), is also available for use as a blocking control in assays to test for specificity of this FGFR1OP antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FGFR0 P antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur FGFR1OP

Antigène: FGFR1OP (FGFR1 Oncogene Partner (FGFR1OP))

Autre désignation: FGFR1OP

Sujet: FGFR1OP is a largely hydrophilic protein postulated to be a leucine-rich protein family member. A t (6,8)(q27,p11) chromosomal translocation, fusing this gene and the fibroblast growth factor receptor 1 (FGFR1) gene, has been found in cases of myeloproliferative disorder. The resulting chimeric protein contains the N-terminal leucine-rich region of this encoded protein fused to the catalytic domain of FGFR1.

Poids moléculaire: 42 kDa (MW of target protein)

Pathways: M Phase, Maintenance of Protein Location, SARS-CoV-2 Protein Interactome