CSNK2A1/CK II alpha anticorps (C-Term)

N° du produit ABIN632224

Cet anticorps Lapin Polyclonal détecte spécifiquement CSNK2A1/CK II alpha dans WB. Il présente une réactivité envers Humain, Souris et Rat.

Aperçu rapide pour CSNK2A1/CK II alpha anticorps (C-Term) (ABIN632224)

Antigène: CSNK2A1/CK II alpha (CSNK2A1) (Casein Kinase 2 alpha 1 (CSNK2A1))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CSNK2A1/CK II alpha est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-CSNK2A1/CK II alpha anticorps

Épitope: C-Term

Specificité: CK2 alpha antibody was raised against the C terminal of CSNK2 A2

Purification: Affinity purified

Immunogène: CK2 alpha antibody was raised using the C terminal of CSNK2 A2 corresponding to a region with amino acids GTEELYGYLKKYHIDLDPHFNDILGQHSRKRWENFIHSENRHLVSPEALD

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CK2 alpha Blocking Peptide, (ABIN938991), is also available for use as a blocking control in assays to test for specificity of this CK2 alpha antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CSNK0 2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CSNK2A1/CK II alpha

Antigène: CSNK2A1/CK II alpha (CSNK2A1) (Casein Kinase 2 alpha 1 (CSNK2A1))

Autre désignation: CK2 alpha

Sujet: CSNK2A2 belongs to the protein kinase superfamily, Ser/Thr protein kinase family, CK2 subfamily. It contains 1 protein kinase domain. Casein kinases are operationally defined by their preferential utilization of acidic proteins such as caseins as substrates. The alpha and alpha' chains contain the catalytic site. CSNK2A2 participates in Wnt signaling. It phosphorylates 'Ser-392' of p53/TP53 following UV irradiation.

Poids moléculaire: 39 kDa (MW of target protein)

Pathways: SARS-CoV-2 Protein Interactome