CSNK2A1/CK II alpha anticorps (C-Term)

N° du produit ABIN632224

Détail du produit anti-CSNK2A1/CK II alpha anticorps

Antigène: CSNK2A1/CK II alpha (CSNK2A1) (Casein Kinase 2 alpha 1 (CSNK2A1))

Épitope: C-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CSNK2A1/CK II alpha est non-conjugé

Application: Western Blotting (WB)

Specificité: CK2 alpha antibody was raised against the C terminal of CSNK2 A2

Purification: Affinity purified

Immunogène: CK2 alpha antibody was raised using the C terminal of CSNK2 A2 corresponding to a region with amino acids GTEELYGYLKKYHIDLDPHFNDILGQHSRKRWENFIHSENRHLVSPEALD

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CK2 alpha Blocking Peptide, catalog no. 33R-3605, is also available for use as a blocking control in assays to test for specificity of this CK2 alpha antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CSNK0 2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CSNK2A1/CK II alpha

Antigène: CSNK2A1/CK II alpha (CSNK2A1) (Casein Kinase 2 alpha 1 (CSNK2A1))

Autre désignation: CK2 alpha (CSNK2A1 Produits)

Synonymes: anticorps CK2A2, anticorps CSNK2A1, anticorps CK2A1, anticorps CKII, anticorps CSNK2A3, anticorps CK2A, anticorps Ck2a, anticorps BmCK2a, anticorps wu:fi38e04, anticorps wu:fi38h03, anticorps csnk2a1, anticorps CK-II, anticorps CK2, anticorps Ckiialpha, anticorps Csnk2a1-rs4, anticorps ck2a1, anticorps casein kinase 2 alpha 2, anticorps casein kinase 2 alpha 1, anticorps casein kinase 2 alpha subunit, anticorps casein kinase 2, alpha 1 polypeptide, anticorps CK2 protein kinase alpha 2, anticorps casein kinase II alpha subunit, anticorps Casein kinase II alpha subunit, anticorps casein kinase 2, alpha 1 polypeptide S homeolog, anticorps CSNK2A2, anticorps CSNK2A1, anticorps ck2a, anticorps Ck2a, anticorps csnk2a1, anticorps cka2, anticorps Ckiialpha, anticorps CK2A1, anticorps Csnk2a1, anticorps csnk2a1.S

Sujet: CSNK2A2 belongs to the protein kinase superfamily, Ser/Thr protein kinase family, CK2 subfamily. It contains 1 protein kinase domain. Casein kinases are operationally defined by their preferential utilization of acidic proteins such as caseins as substrates. The alpha and alpha' chains contain the catalytic site. CSNK2A2 participates in Wnt signaling. It phosphorylates 'Ser-392' of p53/TP53 following UV irradiation.

Poids moléculaire: 39 kDa (MW of target protein)

Pathways: SARS-CoV-2 Protein Interactome