SH3BP4 anticorps (N-Term)

N° du produit ABIN632230

Détail du produit anti-SH3BP4 anticorps

Antigène: SH3BP4 (SH3-Domain Binding Protein 4 (SH3BP4))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SH3BP4 est non-conjugé

Application: Western Blotting (WB)

Specificité: SH3 BP4 antibody was raised against the N terminal of SH3 P4

Purification: Affinity purified

Immunogène: SH3 BP4 antibody was raised using the N terminal of SH3 P4 corresponding to a region with amino acids FTTLKFSKGDHLYVLDTSGGEWWYAHNTTEMGYIPSSYVQPLNYRNSTLS

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SH3BP4 Blocking Peptide, catalog no. 33R-3104, is also available for use as a blocking control in assays to test for specificity of this SH3BP4 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SH0 P4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SH3BP4

Antigène: SH3BP4 (SH3-Domain Binding Protein 4 (SH3BP4))

Autre désignation: SH3BP4 (SH3BP4 Produits)

Synonymes: anticorps BOG25, anticorps TTP, anticorps AI594717, anticorps AW227605, anticorps SH3BP4, anticorps bog25, anticorps ttp, anticorps LOC569399, anticorps sh3bp4, anticorps SH3 domain binding protein 4, anticorps SH3-domain binding protein 4, anticorps SH3-domain binding protein 4 L homeolog, anticorps SH3BP4, anticorps Sh3bp4, anticorps sh3bp4, anticorps sh3bp4.L

Sujet: This gene encodes a protein with 3 Asn-Pro-Phe (NPF) motifs, an SH3 domain, a PXXP motif, a bipartite nuclear targeting signal, and a tyrosine phosphorylation site. This protein is involved in cargo-specific control of clathrin-mediated endocytosis, specifically controlling the internalization of a specific protein receptor.

Poids moléculaire: 107 kDa (MW of target protein)