Casein Kinase 1 gamma 2 anticorps (Middle Region)

N° du produit ABIN632231

Détail du produit anti-Casein Kinase 1 gamma 2 anticorps

Antigène: Casein Kinase 1 gamma 2 (CSNK1G2) (Casein Kinase 1, gamma 2 (CSNK1G2))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Casein Kinase 1 gamma 2 est non-conjugé

Application: Western Blotting (WB)

Specificité: CK1 gamma 2 antibody was raised against the middle region of CSNK1 G2

Purification: Affinity purified

Immunogène: CK1 gamma 2 antibody was raised using the middle region of CSNK1 G2 corresponding to a region with amino acids SKNQALNSTNGELNADDPTAGHSNAPITAPAEVEVADETKCCCFFKRRKR

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CK1 gamma 2 Blocking Peptide, catalog no. 33R-8561, is also available for use as a blocking control in assays to test for specificity of this CK1 gamma 2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CSNK0 2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Casein Kinase 1 gamma 2

Antigène: Casein Kinase 1 gamma 2 (CSNK1G2) (Casein Kinase 1, gamma 2 (CSNK1G2))

Abstract: CSNK1G2 Produits

Synonymes: anticorps CK1g2, anticorps 2810429I12Rik, anticorps AI463719, anticorps CKI, anticorps ck1-gamma, anticorps CSNK1G2, anticorps ck1g2, anticorps csnk1g2, anticorps fj97g11, anticorps wu:fj97g11, anticorps wz8345, anticorps zgc:110719, anticorps zgc:153415, anticorps casein kinase 1 gamma 2, anticorps casein kinase 1, gamma 2, anticorps casein kinase 1 gamma 2 L homeolog, anticorps casein kinase 1, gamma 2a, anticorps casein kinase 1, gamma 2b, anticorps CSNK1G2, anticorps Csnk1g2, anticorps csnk1g2.L, anticorps csnk1g2, anticorps csnk1g2a, anticorps csnk1g2b

Sujet: CSNK1G2 belongs to the protein kinase superfamily, CK1 Ser/Thr protein kinase family, casein kinase I subfamily. It contains 1 protein kinase domain. Casein kinases are operationally defined by their preferential utilization of acidic proteins such as caseins as substrates. It can phosphorylate a large number of proteins. It participates in Wnt signaling.

Poids moléculaire: 47 kDa (MW of target protein)

Pathways: Signalisation Hedgehog