MAP4K1 anticorps (N-Term)
-
- Antigène Voir toutes MAP4K1 Anticorps
- MAP4K1 (Mitogen-Activated Protein Kinase Kinase Kinase Kinase 1 (MAP4K1))
-
Épitope
- N-Term
-
Reactivité
- Humain, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp MAP4K1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- MAP4 K1 antibody was raised against the N terminal of MAP4 1
- Purification
- Affinity purified
- Immunogène
- MAP4 K1 antibody was raised using the N terminal of MAP4 1 corresponding to a region with amino acids VHPLRVLFLMTKSGYQPPRLKEKGKWSAAFHNFIKVTLTKSPKKRPSATK
- Top Product
- Discover our top product MAP4K1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
MAP4K1 Blocking Peptide, catalog no. 33R-9582, is also available for use as a blocking control in assays to test for specificity of this MAP4K1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MAP0 1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- MAP4K1 (Mitogen-Activated Protein Kinase Kinase Kinase Kinase 1 (MAP4K1))
- Autre désignation
- MAP4K1 (MAP4K1 Produits)
- Sujet
- MAP4K1 belongs to the protein kinase superfamily, STE Ser/Thr protein kinase family, STE20 subfamily. MAP4K1 may play a role in the response to environmental stress. It appears to act upstream of the JUN N-terminal pathway. MAP4K1 may play a role in hematopoietic lineage decisions and growth regulation.
- Poids moléculaire
- 90 kDa (MW of target protein)
- Pathways
- TCR Signaling, Signaling of Hepatocyte Growth Factor Receptor
-