BCKDK anticorps (N-Term)

N° du produit ABIN632248

Cet anticorps Lapin Polyclonal détecte spécifiquement BCKDK dans WB. Il présente une réactivité envers Humain, Souris et Rat.

Aperçu rapide pour BCKDK anticorps (N-Term) (ABIN632248)

Antigène: BCKDK (Branched Chain Ketoacid Dehydrogenase Kinase (BCKDK))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp BCKDK est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-BCKDK anticorps

Épitope: N-Term

Specificité: BCKDK antibody was raised against the N terminal of BCKDK

Purification: Affinity purified

Immunogène: BCKDK antibody was raised using the N terminal of BCKDK corresponding to a region with amino acids CLPFIIGCNPTILHVHELYIRAFQKLTDFPPIKDQADEAQYCQLVRQLLD

Information d'application

Indications d'application: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

BCKDK Blocking Peptide, (ABIN937128), is also available for use as a blocking control in assays to test for specificity of this BCKDK antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BCKDK antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur BCKDK

Antigène: BCKDK (Branched Chain Ketoacid Dehydrogenase Kinase (BCKDK))

Autre désignation: BCKDK

Sujet: BCkDaK belongs to the PDK/BCkDaK protein kinase family. It contains 1 histidine kinase domain. BCkDaK catalyzes the phosphorylation and inactivation of the branched-chain alpha-ketoacid dehydrogenase complex, the key regulatory enzyme of the valine, leucine and isoleucine catabolic pathways. BCkDaK is the key enzyme that regulates the activity state of the BCkDa complex.

Poids moléculaire: 43 kDa (MW of target protein)

Pathways: SARS-CoV-2 Protein Interactome