C1orf92 anticorps (Middle Region)

N° du produit ABIN632284

Détail du produit anti-C1orf92 anticorps

Antigène: C1orf92 (LRRC71) (Leucine Rich Repeat Containing 71 (LRRC71))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp C1orf92 est non-conjugé

Application: Western Blotting (WB)

Specificité: C1 ORF92 antibody was raised against the middle region of C1 rf92

Purification: Affinity purified

Immunogène: C1 ORF92 antibody was raised using the middle region of C1 rf92 corresponding to a region with amino acids VDKTDKTQTMKTPKGLGKKKEKSWELAKKEEKLGSGQSPTQGTPKKEDAT

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

C1ORF92 Blocking Peptide, catalog no. 33R-9468, is also available for use as a blocking control in assays to test for specificity of this C1ORF92 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF92 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur C1orf92

Antigène: C1orf92 (LRRC71) (Leucine Rich Repeat Containing 71 (LRRC71))

Autre désignation: C1ORF92 (LRRC71 Produits)

Synonymes: anticorps C1orf92, anticorps RP11-356J7.1, anticorps 4933430H15Rik, anticorps cilia and flagella associated protein 46, anticorps leucine rich repeat containing 71, anticorps cfap46, anticorps LRRC71, anticorps Lrrc71

Sujet: The function of Chromosome 1 ORF protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 39 kDa (MW of target protein)