FAM76A anticorps (Middle Region)

N° du produit ABIN632353

Cet anticorps Lapin Polyclonal détecte spécifiquement FAM76A dans WB. Il présente une réactivité avec des échantillons de Humain, Souris et Rat.

Aperçu rapide pour FAM76A anticorps (Middle Region) (ABIN632353)

Antigène: FAM76A (Family with Sequence Similarity 76, Member A (FAM76A))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp FAM76A est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-FAM76A anticorps

Épitope: Middle Region

Specificité: FAM76 A antibody was raised against the middle region of FAM76

Purification: Affinity purified

Immunogène: FAM76 A antibody was raised using the middle region of FAM76 corresponding to a region with amino acids QCAFDRKDDRKKVDGKLLCWLCTLSYKRVLQKTKEQRKHLSSSSRAGHQE

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

FAM76A Blocking Peptide, (ABIN5613501), is also available for use as a blocking control in assays to test for specificity of this FAM76A antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM70 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur FAM76A

Antigène: FAM76A (Family with Sequence Similarity 76, Member A (FAM76A))

Autre désignation: FAM76A

Sujet: The specific function of FAM76A is not yet known.

Poids moléculaire: 35 kDa (MW of target protein)