OTUB1 anticorps (N-Term)

N° du produit ABIN632375

L’anticorps Lapin Polyclonal anti-OTUB1 a été validé pour WB. Il convient pour détecter OTUB1 dans des échantillons de Humain.

Aperçu rapide pour OTUB1 anticorps (N-Term) (ABIN632375)

Antigène: OTUB1 (OTU Domain, Ubiquitin Aldehyde Binding 1 (OTUB1))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp OTUB1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-OTUB1 anticorps

Épitope: N-Term

Specificité: OTUB1 antibody was raised against the N terminal of OTUB1

Purification: Affinity purified

Immunogène: OTUB1 antibody was raised using the N terminal of OTUB1 corresponding to a region with amino acids DRIQQEIAVQNPLVSERLELSVLYKEYAEDDNIYQQKIKDLHKKYSYIRK

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

OTUB1 Blocking Peptide, (ABIN937531), is also available for use as a blocking control in assays to test for specificity of this OTUB1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of OTUB1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur OTUB1

Antigène: OTUB1 (OTU Domain, Ubiquitin Aldehyde Binding 1 (OTUB1))

Autre désignation: OTUB1

Sujet: The product of this gene is a member of the OTU (ovarian tumor) superfamily of predicted cysteine proteases. The encoded protein is a highly specific ubiquitin iso-peptidase, and cleaves ubiquitin from branched poly-ubiquitin chains but not from ubiquitin.

Poids moléculaire: 31 kDa (MW of target protein)