Desmin anticorps (Middle Region)

N° du produit ABIN632380

Cet anticorps Lapin Polyclonal détecte spécifiquement Desmin dans WB. Il présente une réactivité envers Humain, Rat, Souris et Chien.

Aperçu rapide pour Desmin anticorps (Middle Region) (ABIN632380)

Antigène: Desmin (DES)

Reactivité: Humain, Rat, Souris, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Desmin est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-Desmin anticorps

Épitope: Middle Region

Specificité: Desmin antibody was raised against the middle region of DES

Purification: Affinity purified

Immunogène: Desmin antibody was raised using the middle region of DES corresponding to a region with amino acids MALDVEIATYRKLLEGEESRINLPIQTYSALNFRETSPEQRGSEVHTKKT

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Desmin Blocking Peptide, (ABIN5613180), is also available for use as a blocking control in assays to test for specificity of this Desmin antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DES antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Desmin

Antigène: Desmin (DES)

Autre désignation: Desmin

Sujet: DES is a muscle-specific class III intermediate filament. Homopolymers of this protein form a stable intracytoplasmic filamentous network connecting myofibrils to each other and to the plasma membrane. Mutations in its gene are associated with desmin-related myopathy, a familial cardiac and skeletal myopathy (CSM), and with distal myopathies.

Poids moléculaire: 53 kDa (MW of target protein)