FKBPL anticorps (N-Term)

N° du produit ABIN632388

Cet anticorps anti-FKBPL Polyclonal Lapin (ABIN632388) détecte spécifiquement FKBPL dans WB. L’anticorps est réactif avec des échantillons de Humain.

Aperçu rapide pour FKBPL anticorps (N-Term) (ABIN632388)

Antigène: FKBPL (FK506 Binding Protein Like (FKBPL))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp FKBPL est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-FKBPL anticorps

Épitope: N-Term

Specificité: FKBPL antibody was raised against the N terminal of FKBPL

Purification: Affinity purified

Immunogène: FKBPL antibody was raised using the N terminal of FKBPL corresponding to a region with amino acids AELEGDSHKSHGSTSQMPEALQASDLWYCPDGSFVKKIVIRGHGLDKPKL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

FKBPL Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this FKBPL antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FKBPL antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur FKBPL

Antigène: FKBPL (FK506 Binding Protein Like (FKBPL))

Autre désignation: FKBPL

Sujet: The protein encoded by this gene has similarity to the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking. The encoded protein is thought to have a potential role in the induced radioresistance. Also it appears to have some involvement in the control of the cell cycle.

Poids moléculaire: 38 kDa (MW of target protein)