SCFD1 anticorps (N-Term)

N° du produit ABIN632406

Détail du produit anti-SCFD1 anticorps

Antigène: SCFD1 (Sec1 Family Domain Containing 1 (SCFD1))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SCFD1 est non-conjugé

Application: Western Blotting (WB)

Specificité: SCFD1 antibody was raised against the N terminal of SCFD1

Purification: Affinity purified

Immunogène: SCFD1 antibody was raised using the N terminal of SCFD1 corresponding to a region with amino acids SAVTQVAKVFDQYLNFITLEDDMFVLCNQNKELVSYRAINRPDITDTEME

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SCFD1 Blocking Peptide, catalog no. 33R-8323, is also available for use as a blocking control in assays to test for specificity of this SCFD1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SCFD1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SCFD1

Antigène: SCFD1 (Sec1 Family Domain Containing 1 (SCFD1))

Autre désignation: SCFD1 (SCFD1 Produits)

Synonymes: anticorps DDBDRAFT_0188070, anticorps DDBDRAFT_0234142, anticorps DDB_0188070, anticorps DDB_0234142, anticorps C14orf163, anticorps RA410, anticorps SLY1, anticorps SLY1P, anticorps STXBP1L2, anticorps 3110021P21Rik, anticorps Sly1, anticorps rSly1, anticorps sec1 family domain containing 1, anticorps vesicle transport-related protein, anticorps Sec1-like family protein, anticorps sec1 family domain-containing protein 1, anticorps sec1 family domain containing 1 L homeolog, anticorps Sec1 family domain containing 1, anticorps SCFD1, anticorps PVX_111025, anticorps scfd1, anticorps LOC100639066, anticorps scfd1.L, anticorps Scfd1

Sujet: The function of SCFD1 protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 65 kDa (MW of target protein)