ABHD5 anticorps (C-Term)
-
- Antigène Voir toutes ABHD5 Anticorps
- ABHD5 (Abhydrolase Domain Containing 5 (ABHD5))
-
Épitope
- C-Term
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp ABHD5 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- ABHD5 antibody was raised against the C terminal of ABHD5
- Purification
- Affinity purified
- Immunogène
- ABHD5 antibody was raised using the C terminal of ABHD5 corresponding to a region with amino acids SVIFGARSCIDGNSGTSIQSLRPHSYVKTIAILGAGHYVYADQPEEFNQK
- Top Product
- Discover our top product ABHD5 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
ABHD5 Blocking Peptide, catalog no. 33R-8912, is also available for use as a blocking control in assays to test for specificity of this ABHD5 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ABHD5 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- ABHD5 (Abhydrolase Domain Containing 5 (ABHD5))
- Autre désignation
- ABHD5 (ABHD5 Produits)
- Synonymes
- anticorps ABHD5, anticorps cds, anticorps cgi58, anticorps iecn2, anticorps ncie2, anticorps abhd5, anticorps CDS, anticorps CGI58, anticorps IECN2, anticorps NCIE2, anticorps 1300003D03Rik, anticorps 2010002J10Rik, anticorps CGI-58, anticorps IECN5, anticorps abhydrolase domain containing 5, anticorps abhydrolase domain containing 5a, anticorps abhydrolase domain containing 5 L homeolog, anticorps ABHD5, anticorps abhd5, anticorps abhd5a, anticorps Abhd5, anticorps abhd5.L
- Sujet
- ABHD5 belongs to a large family of proteins defined by an alpha/beta hydrolase fold, and contains three sequence motifs that correspond to a catalytic triad found in the esterase/lipase/thioesterase subfamily. It differs from other members of this subfamily in that its putative catalytic triad contains an asparagine instead of the serine residue. Mutations in this gene have been associated with Chanarin-Dorfman syndrome, a triglyceride storage disease with impaired long-chain fatty acid oxidation.
- Poids moléculaire
- 38 kDa (MW of target protein)
- Pathways
- Lipid Metabolism
-