BEND7 anticorps (Middle Region)

N° du produit ABIN632454

Cet anticorps anti-BEND7 Polyclonal Lapin (ABIN632454) détecte spécifiquement BEND7 dans WB. L’anticorps est réactif avec des échantillons de Humain.

Aperçu rapide pour BEND7 anticorps (Middle Region) (ABIN632454)

Antigène: BEND7 (BEN Domain Containing 7 (BEND7))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp BEND7 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-BEND7 anticorps

Épitope: Middle Region

Specificité: BEND7 antibody was raised against the middle region of BEND7

Purification: Affinity purified

Immunogène: BEND7 antibody was raised using the middle region of BEND7 corresponding to a region with amino acids LGFGIVLESPSSDPEVQLAEGFDVFMPKSQLDSILSNYTRSGSLLFRKLV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

BEND7 Blocking Peptide, (ABIN940357), is also available for use as a blocking control in assays to test for specificity of this BEND7 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BEND7 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur BEND7

Antigène: BEND7 (BEN Domain Containing 7 (BEND7))

Autre désignation: BEND7

Sujet: The function of BEND protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 51 kDa (MW of target protein)