DMBT1 anticorps (N-Term)

N° du produit ABIN632489

Détail du produit anti-DMBT1 anticorps

Antigène: DMBT1 (Deleted in Malignant Brain Tumors 1 (DMBT1))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp DMBT1 est non-conjugé

Application: Western Blotting (WB)

Specificité: DMBT1 antibody was raised against the N terminal of DMBT1

Purification: Affinity purified

Immunogène: DMBT1 antibody was raised using the N terminal of DMBT1 corresponding to a region with amino acids SWSTPSPDTLPTITLPASTVGSESSLALRLVNGGDRCQGRVEVLYRGSWG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

DMBT1 Blocking Peptide, catalog no. 33R-8945, is also available for use as a blocking control in assays to test for specificity of this DMBT1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DMBT1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur DMBT1

Antigène: DMBT1 (Deleted in Malignant Brain Tumors 1 (DMBT1))

Autre désignation: DMBT1 (DMBT1 Produits)

Synonymes: anticorps GP340, anticorps muclin, anticorps CRP, anticorps CRP-[a], anticorps CRP-[b], anticorps Crpd, anticorps DBMT1, anticorps gp300, anticorps p80, anticorps DMBT1, anticorps gp340, anticorps deleted in malignant brain tumors 1, anticorps deleted in malignant brain tumors 1 protein, anticorps gp340, anticorps deleted in malignant brain tumors 1 S homeolog, anticorps DMBT1, anticorps Dmbt1, anticorps LOC100064515, anticorps dmbt1, anticorps ST201phi2-1p340, anticorps dmbt1.S

Sujet: Loss of sequences from human chromosome 10q has been associated with the progression of human cancers. The gene DMBT1 was originally isolated based on its deletion in a medulloblastoma cell line. DMBT1 is expressed with transcripts of 6.0, 7.5, and 8.0 kb in fetal lung and with one transcript of 8.0 kb in adult lung, although the 7.5 kb transcript has not been characterized. The DMBT1 protein is a glycoprotein containing multiple scavenger receptor cysteine-rich (SRCR) domains separated by SRCR-interspersed domains (SID). Transcript variant 2 (8.0 kb) has been shown to bind surfactant protein D independently of carbohydrate recognition. This indicates that DMBT1 may not be a classical tumor supressor gene, but rather play a role in the interaction of tumor cells and the immune system.

Poids moléculaire: 258 kDa (MW of target protein)

Pathways: Activation of Innate immune Response