ADH1B anticorps

N° du produit ABIN632493

Détail du produit anti-ADH1B anticorps

Antigène: ADH1B (Alcohol Dehydrogenase 1B (Class I), beta Polypeptide (ADH1B))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ADH1B est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: ADH1 B antibody was raised using a synthetic peptide corresponding to a region with amino acids STAGKVIKCKAAVLWEVKKPFSIEDVEVAPPKAYEVRIKMVAVGICHTDD

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ADH1B Blocking Peptide, catalog no. 33R-8864, is also available for use as a blocking control in assays to test for specificity of this ADH1B antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ADH0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ADH1B

Antigène: ADH1B (Alcohol Dehydrogenase 1B (Class I), beta Polypeptide (ADH1B))

Autre désignation: ADH1B (ADH1B Produits)

Synonymes: anticorps AO090038000108, anticorps ADH, anticorps Adh-2, anticorps Adh2, anticorps Dvir\\GJ18209, anticorps GJ18209, anticorps dvir_GLEANR_2772, anticorps ADH2, anticorps adh-2, anticorps adh2, anticorps alcohol dehydrogenase 2, anticorps Alcohol dehydrogenase 2, anticorps alcohol dehydrogenase 1B (class I), beta polypeptide, anticorps alcohol dehydrogenase 1B (class I), beta polypeptide L homeolog, anticorps CPR_0442, anticorps AOR_1_236174, anticorps AOR_1_178074, anticorps Dvir\Adh2, anticorps adhB, anticorps ADH2, anticorps ADH1B, anticorps adh1b.L

Sujet: ADH1B is a member of the alcohol dehydrogenase family. Members of this enzyme family metabolize a wide variety of substrates, including ethanol, retinol, other aliphatic alcohols, hydroxysteroids, and lipid peroxidation products. This protein, consisting of several homo- and heterodimers of alpha, beta, and gamma subunits, exhibits high activity for ethanol oxidation and plays a major role in ethanol catabolism.

Poids moléculaire: 40 kDa (MW of target protein)