CHAC1 anticorps

N° du produit ABIN632509

Détail du produit anti-CHAC1 anticorps

Antigène: CHAC1 (ChaC, Cation Transport Regulator Homolog 1 (CHAC1))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CHAC1 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: CHAC1 antibody was raised using a synthetic peptide corresponding to a region with amino acids TPQNPGYLGPAPEEAIATQILACRGFSGHNLEYLLRLADFMQLCGPQAQD

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CHAC1 Blocking Peptide, catalog no. 33R-9229, is also available for use as a blocking control in assays to test for specificity of this CHAC1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CHAC1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CHAC1

Antigène: CHAC1 (ChaC, Cation Transport Regulator Homolog 1 (CHAC1))

Autre désignation: CHAC1 (CHAC1 Produits)

Synonymes: anticorps 1810008K03Rik, anticorps RGD1307153, anticorps ChaC glutathione specific gamma-glutamylcyclotransferase 1, anticorps ChaC, cation transport regulator 1, anticorps ChaC glutathione-specific gamma-glutamylcyclotransferase 1, anticorps CHAC1, anticorps Chac1

Sujet: CHAC1 belongs to the chaC family. The exact function of CHAC1 remains unknown.

Poids moléculaire: 24 kDa (MW of target protein)