KCTD16 anticorps (N-Term)

N° du produit ABIN632535

Cet anticorps anti-KCTD16 est un anticorps Lapin Polyclonal détectant KCTD16 dans WB. Adapté pour Humain.

Aperçu rapide pour KCTD16 anticorps (N-Term) (ABIN632535)

Antigène: KCTD16 (Potassium Channel Tetramerisation Domain Containing 16 (KCTD16))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp KCTD16 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-KCTD16 anticorps

Épitope: N-Term

Specificité: KCTD16 antibody was raised against the N terminal of KCTD16

Purification: Affinity purified

Immunogène: KCTD16 antibody was raised using the N terminal of KCTD16 corresponding to a region with amino acids KREAEYFQLPDLVKLLTPDEIKQSPDEFCHSDFEDASQGSDTRICPPSSL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

KCTD16 Blocking Peptide, (ABIN940007), is also available for use as a blocking control in assays to test for specificity of this KCTD16 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCTD16 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur KCTD16

Antigène: KCTD16 (Potassium Channel Tetramerisation Domain Containing 16 (KCTD16))

Autre désignation: KCTD16

Sujet: KCTD16 is an auxiliary subunit of GABA-B receptors that determine the pharmacology and kinetics of the receptor response. It increases agonist potency and markedly alter the G-protein signaling of the receptors by accelerating onset and promoting desensitization.

Poids moléculaire: 49 kDa (MW of target protein)

Pathways: Synaptic Membrane, Regulation of G-Protein Coupled Receptor Protein Signaling