KCTD16 anticorps (N-Term)

N° du produit ABIN632535

Détail du produit anti-KCTD16 anticorps

Antigène: KCTD16 (Potassium Channel Tetramerisation Domain Containing 16 (KCTD16))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp KCTD16 est non-conjugé

Application: Western Blotting (WB)

Specificité: KCTD16 antibody was raised against the N terminal of KCTD16

Purification: Affinity purified

Immunogène: KCTD16 antibody was raised using the N terminal of KCTD16 corresponding to a region with amino acids KREAEYFQLPDLVKLLTPDEIKQSPDEFCHSDFEDASQGSDTRICPPSSL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

KCTD16 Blocking Peptide, catalog no. 33R-4621, is also available for use as a blocking control in assays to test for specificity of this KCTD16 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCTD16 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur KCTD16

Antigène: KCTD16 (Potassium Channel Tetramerisation Domain Containing 16 (KCTD16))

Autre désignation: KCTD16 (KCTD16 Produits)

Synonymes: anticorps RGD1559856, anticorps 4930434H12Rik, anticorps Gm1267, anticorps lrl1, anticorps lrl3, anticorps potassium channel tetramerization domain containing 16, anticorps potassium channel tetramerisation domain containing 16, anticorps potassium channel tetramerization domain containing 16a, anticorps potassium channel tetramerization domain containing 16b, anticorps Kctd16, anticorps KCTD16, anticorps kctd16, anticorps kctd16a, anticorps kctd16b

Sujet: KCTD16 is an auxiliary subunit of GABA-B receptors that determine the pharmacology and kinetics of the receptor response. It increases agonist potency and markedly alter the G-protein signaling of the receptors by accelerating onset and promoting desensitization.

Poids moléculaire: 49 kDa (MW of target protein)

Pathways: Synaptic Membrane, Regulation of G-Protein Coupled Receptor Protein Signaling