DPH1 anticorps

N° du produit ABIN632548

Cet anticorps Lapin Polyclonal détecte spécifiquement DPH1 dans WB. Il présente une réactivité envers Humain.

Aperçu rapide pour DPH1 anticorps (ABIN632548)

Antigène: DPH1 (DPH1 Homolog (DPH1))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp DPH1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-DPH1 anticorps

Purification: Affinity purified

Immunogène: DPH1 antibody was raised using a synthetic peptide corresponding to a region with amino acids NQIPPEILKNPQLQAAIRVLPSNYNFEIPKTIWRIQQAQAKKVALQMPEG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

DPH1 Blocking Peptide, (ABIN5613243), is also available for use as a blocking control in assays to test for specificity of this DPH1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DPH1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur DPH1

Antigène: DPH1 (DPH1 Homolog (DPH1))

Autre désignation: DPH1

Sujet: Diphthamide is a unique posttranslationally modified histidine found only in translation elongation factor-2 . This modification is conserved from archaebacteria to humans and serves as the target for ADP-ribosylation and inactivation of EEF2 by diphtheria toxin (DT) and Pseudomonas exotoxin A.

Poids moléculaire: 49 kDa (MW of target protein)