DPH1 anticorps
-
- Antigène Voir toutes DPH1 Anticorps
- DPH1 (DPH1 Homolog (DPH1))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp DPH1 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- DPH1 antibody was raised using a synthetic peptide corresponding to a region with amino acids NQIPPEILKNPQLQAAIRVLPSNYNFEIPKTIWRIQQAQAKKVALQMPEG
- Top Product
- Discover our top product DPH1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
DPH1 Blocking Peptide, catalog no. 33R-6839, is also available for use as a blocking control in assays to test for specificity of this DPH1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DPH1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- DPH1 (DPH1 Homolog (DPH1))
- Autre désignation
- DPH1 (DPH1 Produits)
- Synonymes
- anticorps DPH1, anticorps DPH1-OVCA2, anticorps dph1-ovca2, anticorps dph2l, anticorps dph2l1, anticorps ovca1, anticorps DPH2L, anticorps DPH2L1, anticorps OVCA1, anticorps zgc:110702, anticorps 2310011M22Rik, anticorps 4930488F09Rik, anticorps AW551873, anticorps Dph2l1, anticorps Ovca1, anticorps RGD1562694, anticorps diphthamide biosynthesis 1, anticorps diphthamide biosynthesis protein 1, anticorps diphthamide biosynthesis 1 L homeolog, anticorps 2-(3-amino-3-carboxypropyl)histidine synthase subunit 1, anticorps DPH1, anticorps NCU08503, anticorps ATEG_01183, anticorps LELG_00973, anticorps HCAG_03806, anticorps AOR_1_728014, anticorps PTRG_05729, anticorps CTRG_01524, anticorps UREG_06411, anticorps BDBG_05574, anticorps MCYG_04396, anticorps PITG_12187, anticorps MGYG_02224, anticorps LOC100284663, anticorps dph1.L, anticorps dph1, anticorps Dph1, anticorps dph-1
- Sujet
- Diphthamide is a unique posttranslationally modified histidine found only in translation elongation factor-2 . This modification is conserved from archaebacteria to humans and serves as the target for ADP-ribosylation and inactivation of EEF2 by diphtheria toxin (DT) and Pseudomonas exotoxin A.
- Poids moléculaire
- 49 kDa (MW of target protein)
-