APOA2 anticorps (N-Term)

N° du produit ABIN632553

Détail du produit anti-APOA2 anticorps

Antigène: APOA2 (Apolipoprotein A-II (APOA2))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp APOA2 est non-conjugé

Application: Western Blotting (WB)

Specificité: ApoA-II antibody was raised against the N terminal of APOA2

Purification: Affinity purified

Immunogène: ApoA-II antibody was raised using the N terminal of APOA2 corresponding to a region with amino acids MKLLAATVLLLTICSLEGALVRRQAKEPCVESLVSQYFQTVTDYGKDLME

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ApoA-II Blocking Peptide, catalog no. 33R-6151, is also available for use as a blocking control in assays to test for specificity of this ApoA-II antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of APOA2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur APOA2

Antigène: APOA2 (Apolipoprotein A-II (APOA2))

Autre désignation: ApoA-II (APOA2 Produits)

Synonymes: anticorps Apo-AII, anticorps ApoA-II, anticorps apoAII, anticorps Alp-2, anticorps ApoAII, anticorps Apoa-2, anticorps Hdl-1, anticorps APOAII, anticorps apoa2, anticorps apoA-II, anticorps cb1032, anticorps wu:fb57h11, anticorps zgc:193613, anticorps apolipoprotein A2, anticorps apolipoprotein A-II, anticorps APOA2, anticorps Apoa2, anticorps apoa2

Sujet: This gene encodes apolipoprotein (apo-) A-II, which is the second most abundant protein of the high density lipoprotein particles. The protein is found in plasma as a monomer, homodimer, or heterodimer with apolipoprotein D. Defects in this gene may result in apolipoprotein A-II deficiency or hypercholesterolemia.

Poids moléculaire: 9 kDa (MW of target protein)

Pathways: Regulation of Lipid Metabolism by PPARalpha, Production of Molecular Mediator of Immune Response, Negative Regulation of Transporter Activity, Lipid Metabolism