SENP2 anticorps (Middle Region)

N° du produit ABIN632554

Cet anticorps Lapin Polyclonal détecte spécifiquement SENP2 dans WB. Il présente une réactivité avec des échantillons de Humain.

Aperçu rapide pour SENP2 anticorps (Middle Region) (ABIN632554)

Antigène: SENP2 (SUMO1/sentrin/SMT3 Specific Peptidase 2 (SENP2))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SENP2 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-SENP2 anticorps

Épitope: Middle Region

Specificité: SENP2 antibody was raised against the middle region of SENP2

Purification: Affinity purified

Immunogène: SENP2 antibody was raised using the middle region of SENP2 corresponding to a region with amino acids RICEILLQYLQDESKTKRNSDLNLLEWTHHSMKPHEIPQQLNGSDCGMFT

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SENP2 Blocking Peptide, (ABIN5616042), is also available for use as a blocking control in assays to test for specificity of this SENP2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SENP2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SENP2

Antigène: SENP2 (SUMO1/sentrin/SMT3 Specific Peptidase 2 (SENP2))

Autre désignation: SENP2

Sujet: SUMO1 is a small ubiquitin-like protein that can be covalently conjugated to other proteins. SENP2 is one of a group of enzymes that process newly synthesized SUMO1 into the conjugatable form and catalyze the deconjugation of SUMO1-containing species.

Poids moléculaire: 68 kDa (MW of target protein)

Pathways: Chromatin Binding