PNRC2 anticorps (Middle Region)

N° du produit ABIN632558

Détail du produit anti-PNRC2 anticorps

Antigène: PNRC2 (Proline Rich Nuclear Receptor Coactivator 2 (PNRC2))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PNRC2 est non-conjugé

Application: Western Blotting (WB)

Specificité: PNRC2 antibody was raised against the middle region of PNRC2

Purification: Affinity purified

Immunogène: PNRC2 antibody was raised using the middle region of PNRC2 corresponding to a region with amino acids NQSWNSSLSGPRLLFKSQANQNYAGAKFSEPPSPSVLPKPPSHWVPVSFN

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PNRC2 Blocking Peptide, catalog no. 33R-6847, is also available for use as a blocking control in assays to test for specificity of this PNRC2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PNRC2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PNRC2

Antigène: PNRC2 (Proline Rich Nuclear Receptor Coactivator 2 (PNRC2))

Autre désignation: PNRC2 (PNRC2 Produits)

Synonymes: anticorps 0610011E17Rik, anticorps D4Bwg0593e, anticorps wu:cegs2777, anticorps wu:fb51a04, anticorps wu:fb81a06, anticorps wu:fd19g06, anticorps proline rich nuclear receptor coactivator 2, anticorps proline-rich nuclear receptor coactivator 2, anticorps PNRC2, anticorps Pnrc2, anticorps pnrc2

Sujet: PNRC2 is involved in nonsense-mediated mRNA decay (NMD) by acting as a bridge between the mRNA decapping complex and the NMD machinery.PNRC2 may act by targeting the NMD machinery to the P-body and recruiting the decapping machinery to aberrant mRNAs. PNRC2 is required for UPF1/RENT1 localization to the P-body. PNRC2 also acts as a nuclear receptor coactivator. PNRC2 may play a role in controlling the energy balance between energy storage and energy expenditure.

Poids moléculaire: 15 kDa (MW of target protein)