C2orf30 anticorps (Middle Region)

N° du produit ABIN632582

L’anticorps Lapin Polyclonal anti-C2orf30 a été validé pour WB. Il convient pour détecter C2orf30 dans des échantillons de Humain.

Aperçu rapide pour C2orf30 anticorps (Middle Region) (ABIN632582)

Antigène: C2orf30 (ERLEC1) (Endoplasmic Reticulum Lectin 1 (ERLEC1))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp C2orf30 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-C2orf30 anticorps

Épitope: Middle Region

Specificité: C2 orf30 antibody was raised against the middle region of C2 rf30

Purification: Affinity purified

Immunogène: C2 orf30 antibody was raised using the middle region of C2 rf30 corresponding to a region with amino acids GKHVHQYHEDKDSGKTSVVVGTWNQEEHIEWAKKNTARAYHLQDDGTQTV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

C2orf30 Blocking Peptide, (ABIN938749), is also available for use as a blocking control in assays to test for specificity of this C2orf30 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 rf30 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur C2orf30

Antigène: C2orf30 (ERLEC1) (Endoplasmic Reticulum Lectin 1 (ERLEC1))

Autre désignation: C2orf30

Sujet: C2orf30 is a probable lectin that binds selectively to improperly folded lumenal proteins. May function in endoplasmic reticulum quality control and endoplasmic reticulum-associated degradation (ERAD) of both non-glycosylated proteins and glycoproteins.

Poids moléculaire: 55 kDa (MW of target protein)

Pathways: SARS-CoV-2 Protein Interactome