C2orf30 anticorps (Middle Region)

N° du produit ABIN632582

Détail du produit anti-C2orf30 anticorps

Antigène: C2orf30 (ERLEC1) (Endoplasmic Reticulum Lectin 1 (ERLEC1))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp C2orf30 est non-conjugé

Application: Western Blotting (WB)

Specificité: C2 orf30 antibody was raised against the middle region of C2 rf30

Purification: Affinity purified

Immunogène: C2 orf30 antibody was raised using the middle region of C2 rf30 corresponding to a region with amino acids GKHVHQYHEDKDSGKTSVVVGTWNQEEHIEWAKKNTARAYHLQDDGTQTV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

C2orf30 Blocking Peptide, catalog no. 33R-3363, is also available for use as a blocking control in assays to test for specificity of this C2orf30 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 rf30 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur C2orf30

Antigène: C2orf30 (ERLEC1) (Endoplasmic Reticulum Lectin 1 (ERLEC1))

Autre désignation: C2orf30 (ERLEC1 Produits)

Synonymes: anticorps C2orf30, anticorps CIM, anticorps CL24936, anticorps CL25084, anticorps XTP3-B, anticorps XTP3TPB, anticorps 4933407N01Rik, anticorps endoplasmic reticulum lectin 1, anticorps ERLEC1, anticorps Erlec1

Sujet: C2orf30 is a probable lectin that binds selectively to improperly folded lumenal proteins. May function in endoplasmic reticulum quality control and endoplasmic reticulum-associated degradation (ERAD) of both non-glycosylated proteins and glycoproteins.

Poids moléculaire: 55 kDa (MW of target protein)

Pathways: SARS-CoV-2 Protein Interactome