PLA2G4E anticorps (C-Term)

N° du produit ABIN632624

Détail du produit anti-PLA2G4E anticorps

Antigène: PLA2G4E (Phospholipase A2, Group IVE (PLA2G4E))

Épitope: C-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PLA2G4E est non-conjugé

Application: Western Blotting (WB)

Specificité: PLA2 G2 antibody was raised against the c terminal of PLA2 2

Purification: Affinity purified

Immunogène: PLA2 G2 antibody was raised using the C terminal of PLA2 2 corresponding to a region with amino acids TFFPLINDTFRKYKAPGVERSPEELEQGQVDIYGPKTPYATKELTYTEAT

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PLA2G4E Blocking Peptide, catalog no. 33R-9063, is also available for use as a blocking control in assays to test for specificity of this PLA2G4E antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PLA0 0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PLA2G4E

Antigène: PLA2G4E (Phospholipase A2, Group IVE (PLA2G4E))

Autre désignation: PLA2G4E (PLA2G4E Produits)

Synonymes: anticorps RGD1310595, anticorps 2310026J01Rik, anticorps C230096D22, anticorps Pla2epsilon, anticorps phospholipase A2, group IVE, anticorps phospholipase A2 group IVE-like 6, anticorps phospholipase A2 group IVE, anticorps Pla2g4e, anticorps PLA2G4EL6, anticorps PLA2G4E

Sujet: PLA2G4E is a calcium-dependent phospholipase A2 that selectively hydrolyzes glycerophospholipids in the sn-2 position.

Poids moléculaire: 96 kDa (MW of target protein)

Pathways: Inositol Metabolic Process, VEGF Signaling