TBC1D24 anticorps (Middle Region)

N° du produit ABIN632637

Détail du produit anti-TBC1D24 anticorps

Antigène: TBC1D24 (TBC1 Domain Family, Member 24 (TBC1D24))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TBC1D24 est non-conjugé

Application: Western Blotting (WB)

Specificité: TBC1 D24 antibody was raised against the middle region of TBC1 24

Purification: Affinity purified

Immunogène: TBC1 D24 antibody was raised using the middle region of TBC1 24 corresponding to a region with amino acids SDPADRLSPFLAARHFNLPSKTESMFMAGGSDCLIVGGGGGQALYIDGDL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TBC1D24 Blocking Peptide, catalog no. 33R-8365, is also available for use as a blocking control in assays to test for specificity of this TBC1D24 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TBC0 24 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TBC1D24

Antigène: TBC1D24 (TBC1 Domain Family, Member 24 (TBC1D24))

Autre désignation: TBC1D24 (TBC1D24 Produits)

Synonymes: anticorps RGD1306143, anticorps EIEE16, anticorps FIME, anticorps TLDC6, anticorps 9630033P11, anticorps C530046L02Rik, anticorps mKIAA1171, anticorps tbc1d24, anticorps TBC1 domain family, member 24, anticorps ATPase H+ transporting V0 subunit c, anticorps TBC1 domain family member 24, anticorps TBC1 domain family member 24 L homeolog, anticorps Tbc1d24, anticorps ATP6V0C, anticorps TBC1D24, anticorps tbc1d24.1.L

Sujet: TBC1D24 may act as a GTPase-activating protein for Rab family proteins.

Poids moléculaire: 62 kDa (MW of target protein)