PLSCR1 anticorps (N-Term)

N° du produit ABIN632641

Cet anticorps Lapin Polyclonal détecte spécifiquement PLSCR1 dans WB. Il présente une réactivité envers Humain.

Aperçu rapide pour PLSCR1 anticorps (N-Term) (ABIN632641)

Antigène: PLSCR1 (phospholipid Scramblase 1 (PLSCR1))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PLSCR1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-PLSCR1 anticorps

Épitope: N-Term

Specificité: PLSCR1 antibody was raised against the N terminal of PLSCR1

Purification: Affinity purified

Immunogène: PLSCR1 antibody was raised using the N terminal of PLSCR1 corresponding to a region with amino acids MDKQNSQMNASHPETNLPVGYPPQYPPTAFQGPPGYSGYPGPQVSYPPPP

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PLSCR1 Blocking Peptide, (ABIN5615424), is also available for use as a blocking control in assays to test for specificity of this PLSCR1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PLSCR1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PLSCR1

Antigène: PLSCR1 (phospholipid Scramblase 1 (PLSCR1))

Autre désignation: PLSCR1

Sujet: PLSCR1 may mediate accelerated ATP-independent bidirectional transbilayer migration of phospholipids upon binding calcium ions that results in a loss of phospholipid asymmetry in the plasma membrane.PLSCR1 may play a central role in the initiation of fibrin clot formation, in the activation of mast cells and in the recognition of apoptotic and injured cells by the reticuloendothelial system.

Poids moléculaire: 35 kDa (MW of target protein)

Pathways: Cellular Response to Molecule of Bacterial Origin